staufen, RNA binding protein, homolog 1 (Drosophila), Mouse, Clone: 1E7, Abnova™

Catalog No.	Quantity
89-000-987	100 μg

Catalog No. 89-000-987 Supplier Abnova Corporation Supplier No. H00006780M02

Description

Mouse monoclonal antibody raised against a partial recombinant STAU1.

Staufen is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. The human homologue of staufen encoded by STAU, in addition contains a microtubule- binding domain similar to that of microtubule-associated protein 1B, and binds tubulin. The STAU gene product has been shown to be present in the cytoplasm in association with the rough endoplasmic reticulum (RER), implicating this protein in the transport of mRNA via the microtubule network to the RER, the site of translation. Five transcript variants resulting from alternative splicing of STAU gene and encoding three isoforms have been described. Three of these variants encode the same isoform, however, differ in their 5'UTR. [provided by RefSeq]

Sequence: PHGPLTRPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQSTEMPRTGNGPMSVCGRC

Specifications

• Antigen: staufen, RNA binding protein, homolog 1 (Drosophila)
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 1E7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant STAU1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: STAU1
• Gene Accession No.: NM_004602
• Gene Alias: FLJ25010/STAU
• Gene Symbols: STAU1
• Host Species: Mouse
• Immunogen: STAU1 (NP_004593, 401 a.a. ∼ 496 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6780
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ