staufen, RNA binding protein, homolog 2 (Drosophila), Mouse, Clone: 6F9, Abnova™

Catalog No.	Quantity
89-001-249	100 μg

Catalog No. 89-001-249 Supplier Abnova Corporation Supplier No. H00027067M03

Description

Mouse monoclonal antibody raised against a partial recombinant STAU2.

Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of multiple dsRNA-binding domains which are required to bind RNAs having double-stranded secondary structures. Staufen homolog 2 shares 48.5% and 59.9% similarity with drosophila and human staufen, respectively. The exact function of Staufen homolog 2 is not known, but since it contains 3 copies of conserved dsRNA binding domain, it could be involved in double-stranded RNA binding events. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: LQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFP

Specifications

• Antigen: staufen, RNA binding protein, homolog 2 (Drosophila)
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 6F9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant STAU2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: STAU2
• Gene Accession No.: NM_014393
• Gene Alias: 39K2/39K3/DKFZp781K0371/MGC119606
• Gene Symbols: STAU2
• Host Species: Mouse
• Immunogen: STAU2 (NP_055208, 2 a.a. ∼ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 27067
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ