stress-induced-phosphoprotein 1, Mouse, Clone: 1E3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant STIP1.

Supplier:  Abnova Corporation H00010963M11

Catalog No. 89-001-198

Description

STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]).[supplied by OMIM

Sequence: TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR

Specifications

• Antigen: stress-induced-phosphoprotein 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_006819
• Gene Symbols: STIP1
• Immunogen: STIP1 (NP_006810.1, 445 a.a. ∼ 543 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 10963
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 1E3
• Description: Mouse monoclonal antibody raised against a partial recombinant STIP1.
• Gene: STIP1
• Gene Alias: HOP/IEF-SSP-3521/P60/STI1/STI1L
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody