Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001124

serine/threonine kinase 17a, Mouse, Clone: 3G8, Abnova™

Catalog No. 89001124 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-124 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-124 Supplier Abnova Corporation Supplier No. H00009263M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant STK17A.

This gene is a member of the DAP kinase-related apoptosis-inducing protein kinase family and encodes an autophosphorylated nuclear protein with a protein kinase domain. The protein has apoptosis-inducing activity. [provided by RefSeq

Sequence: LLVKKPEDRATAEECLKHPWLTQSSIQEPSFRMEKALEEANALQEGHSVPEINSDTDKSETEESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGEFI

Specifications

Antigen serine/threonine kinase 17a
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3G8
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant STK17A.
Formulation PBS with no preservative; pH 7.4
Gene STK17A
Gene Accession No. BC047696
Gene Alias DRAK1
Gene Symbols STK17A
Host Species Mouse
Immunogen STK17A (AAH47696, 301 a.a. ∼ 413 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Apoptosis
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 9263
Target Species Human, Mouse
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.