Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

serine/threonine kinase 32A, Mouse, Clone: 3B3, Abnova™

Catalog No. 89001406 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-406 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-406 Supplier Abnova Corporation Supplier No. H00202374M04
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant STK32A.

Sequence: NVFKELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFKEETVKLFICELVMALDYLQNQRIIHRDMKPDNILLDEHDTWLSYKSH

Specifications

Antigen serine/threonine kinase 32A
Applications ELISA
Classification Monoclonal
Clone 3B3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant STK32A.
Formulation PBS with no preservative; pH 7.4
Gene STK32A
Gene Accession No. BC021666
Gene Alias MGC22688/YANK1
Gene Symbols STK32A
Host Species Mouse
Immunogen STK32A (AAH21666, 67 a.a. ∼ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Kinases
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 202374
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.