Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

serine/threonine kinase 38, Mouse, Clone: 2G8-1F3, Abnova™

Catalog No. 89014280 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-280 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-280 Supplier Abnova Corporation Supplier No. H00011329M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a full-length recombinant STK38.

Sequence: MAMTGSTPCSSMSNHTKERVTMTKVTLENFSSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPISEKAKDLILRFCCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVAISNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK

Specifications

Antigen serine/threonine kinase 38
Applications ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 2G8-1F3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant STK38.
Formulation PBS with no preservative; pH 7.4
Gene STK38
Gene Accession No. BC012085
Gene Alias NDR/NDR1
Gene Symbols STK38
Host Species Mouse
Immunogen STK38 (AAH12085, 1 a.a. ∼ 465 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Kinases
Primary or Secondary Primary
Gene ID (Entrez) 11329
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.