serine/threonine kinase 38, Mouse, Clone: 2G8-1F3, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant STK38.

Supplier:  Abnova Corporation H00011329M01

Catalog No. 89-014-280

Description

Sequence: MAMTGSTPCSSMSNHTKERVTMTKVTLENFSSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPISEKAKDLILRFCCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVAISNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK

Specifications

• Antigen: serine/threonine kinase 38
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC012085
• Gene Symbols: STK38
• Immunogen: STK38 (AAH12085, 1 a.a. ∼ 465 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Kinases
• Gene ID (Entrez): 11329
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Immunoprecipitation, Western Blot
• Clone: 2G8-1F3
• Description: Mouse monoclonal antibody raised against a full length recombinant STK38.
• Gene: STK38
• Gene Alias: NDR/NDR1
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody