stathmin 1/oncoprotein 18, Mouse, Clone: 3A9, Abnova™

Mouse monoclonal antibody raised against a partial recombinant STMN1.

Supplier:  Abnova Corporation H00003925M01A

Catalog No. 89-001-466

Description

This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: PKKKDFSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD

Specifications

• Antigen: stathmin 1/oncoprotein 18
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: BC014353
• Gene Symbols: STMN1
• Immunogen: STMN1 (AAH14353, 40 a.a. ∼ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 3925
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Immunoprecipitation, Western Blot
• Clone: 3A9
• Description: Mouse monoclonal antibody raised against a partial recombinant STMN1.
• Gene: STMN1
• Gene Alias: LAP18/Lag/OP18/PP17/PP19/PR22/SMN
• Host Species: Mouse
• Quantity: 200 μL
• Research Discipline: Signal Transduction
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgM κ