stathmin 1/oncoprotein 18, Mouse, Clone: 3A9, Abnova™

Catalog No.	Quantity
89-001-466	200 μL

Catalog No. 89-001-466 Supplier Abnova Corporation Supplier No. H00003925M01A

Description

Mouse monoclonal antibody raised against a partial recombinant STMN1.

This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: PKKKDFSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD

Specifications

• Antigen: stathmin 1/oncoprotein 18
• Applications: ELISA, Immunoprecipitation, Western Blot
• Classification: Monoclonal
• Clone: 3A9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant STMN1.
• Formulation: ascites with no preservative
• Gene: STMN1
• Gene Accession No.: BC014353
• Gene Alias: LAP18/Lag/OP18/PP17/PP19/PR22/SMN
• Gene Symbols: STMN1
• Host Species: Mouse
• Immunogen: STMN1 (AAH14353, 40 a.a. ∼ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Research Discipline: Signal Transduction
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 3925
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ