STMN2, Mouse, Clone: 3B12, Abnova™

Mouse monoclonal antibody raised against a partial recombinant STMN2.

Supplier:  Abnova Corporation H00011075M01A

Catalog No. 89-123-123

Description

Superior cervical ganglion-10 is a neuronal growth-associated protein that shares significant amino acid sequence similarity with the phosphoprotein stathmin (MIM 151442).[supplied by OMIM

Sequence: MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRASGQAFELILKPPSPISEAPRTLASPKKKDLSLEEIQKKLEA

Specifications

• Antigen: STMN2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: ascites with no preservative
• Gene Accession No.: NM_007029
• Gene Symbols: STMN2
• Immunogen: STMN2 (NP_008960, 1 a.a. ∼ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 11075
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Ascites

• Applications: ELISA, Western Blot
• Clone: 3B12
• Description: Mouse monoclonal antibody raised against a partial recombinant STMN2.
• Gene: STMN2
• Gene Alias: SCG10/SCGN10/SGC10
• Host Species: Mouse
• Quantity: 200 μL
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgM κ