syntaxin 1A (brain), Mouse, Clone: 1B11-1A8, Abnova™

Catalog No.	Quantity
89-000-991	100 μg

Catalog No. 89-000-991 Supplier Abnova Corporation Supplier No. H00006804M02

Description

Mouse monoclonal antibody raised against a full-length recombinant STX1A.

Synaptic vesicles store neurotransmitters that are released during calcium-regulated exocytosis. The specificity of neurotransmitter release requires the localization of both synaptic vesicles and calcium channels to the presynaptic active zone. Syntaxins function in this vesicle fusion process. Syntaxins also serve as a substrate for botulinum neurotoxin type C, a metalloprotease that blocks exocytosis and has high affinity for a molecular complex that includes the alpha-latrotoxin receptor (MIM 600565) which produces explosive exocytosis (Zhang et al., 1995 [PubMed 7622072]).[supplied by OMIM

Sequence: MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQTMWRGPCLTPRRPSSTRARRAGRKS

Specifications

• Antigen: syntaxin 1A (brain)
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 1B11-1A8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant STX1A.
• Formulation: PBS with no preservative; pH 7.4
• Gene: STX1A
• Gene Accession No.: BC003011.1
• Gene Alias: HPC-1/STX1/p35-1
• Gene Symbols: STX1A
• Host Species: Mouse
• Immunogen: STX1A (AAH03011.1, 1 a.a. ∼ 251 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6804
• Target Species: Human, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ