Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89018295

syntaxin 1A (brain), Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No. 89018295 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-018-295 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-018-295 Supplier Abnova Corporation Supplier No. H00006804D01P
Add to Cart
Add to Cart

Description

Rabbit polyclonal antibody raised against a full-length human STX1A protein.

Synaptic vesicles store neurotransmitters that are released during calcium-regulated exocytosis. The specificity of neurotransmitter release requires the localization of both synaptic vesicles and calcium channels to the presynaptic active zone. Syntaxins function in this vesicle fusion process. Syntaxins also serve as a substrate for botulinum neurotoxin type C, a metalloprotease that blocks exocytosis and has high affinity for a molecular complex that includes the alpha-latrotoxin receptor (MIM 600565) which produces explosive exocytosis (Zhang et al., 1995 [PubMed 7622072]).[supplied by OMIM

Sequence: MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQTMWRGPCLTPRRPSSTRARRAGRKS

Specifications

Antigen syntaxin 1A (brain)
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Rabbit polyclonal antibody raised against a full-length human STX1A protein.
Formulation PBS with no preservative; pH 7.4
Gene STX1A
Gene Accession No. BC003011.1
Gene Alias HPC-1/STX1/p35-1
Gene Symbols STX1A
Host Species Rabbit
Immunogen STX1A (AAH03011.1, 1 a.a. ∼ 251 a.a) full-length human protein.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6804
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.