Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

serine/threonine/tyrosine kinase 1, Mouse, Clone: 3D2, Abnova™

Catalog No. 89001306 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-306 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-306 Supplier Abnova Corporation Supplier No. H00055359M02
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant STYK1.

Receptor protein tyrosine kinases, like STYK1, play important roles in diverse cellular and developmental processes, such as cell proliferation, differentiation, and survival (Liu et al., 2004 [PubMed 15150103]).[supplied by OMIM

Sequence: REQRTQQQRSGPQGIAPVPPPRDLSWEAGHGGNVALPLKETSVENFLGATTPALAKLQVPREQLSEVLEQICSGSCGPIFRANMNTGDPSKPKSVILKALKEPAGLHEVQ

Specifications

Antigen serine/threonine/tyrosine kinase 1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3D2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant STYK1.
Formulation PBS with no preservative; pH 7.4
Gene STYK1
Gene Accession No. NM_018423
Gene Alias DKFZp761P1010/NOK/SuRTK106
Gene Symbols STYK1
Host Species Mouse
Immunogen STYK1 (NP_060893, 50 a.a. ∼ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Kinases
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 55359
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.