sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-018-298	100 μg

Catalog No. 89-018-298 Supplier Abnova Corporation Supplier No. H00006817D01P

Description

Rabbit polyclonal antibody raised against a full-length human SULT1A1 protein.

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes one of two phenol sulfotransferases with thermostable enzyme activity. Multiple alternatively spliced variants that encode two isoforms have been identified for this gene. [provided by RefSeq

Sequence: MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Specifications

• Antigen: sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against a full-length human SULT1A1 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SULT1A1
• Gene Accession No.: BC000923.2
• Gene Alias: HAST1/HAST2/MGC131921/MGC5163/P-PST/PST/ST1A3/STP/STP1/TSPST1
• Gene Symbols: SULT1A1
• Host Species: Rabbit
• Immunogen: SULT1A1 (AAH00923.1, 1 a.a. ∼ 295 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6817
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG