sulfotransferase family, cytosolic, 2B, member 1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-329	50 μL

Catalog No. 89-004-329 Supplier Abnova Corporation Supplier No. H00006820A01

Description

Mouse polyclonal antibody raised against a partial recombinant SULT2B1.

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene sulfates dehydroepiandrosterone but not 4-nitrophenol, a typical substrate for the phenol and estrogen sulfotransferase subfamilies. Two alternatively spliced variants that encode different isoforms have been described. [provided by RefSeq

Sequence: MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPKSGTTWMIEIICLILKEGDPS

Specifications

• Antigen: sulfotransferase family, cytosolic, 2B, member 1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant SULT2B1.
• Formulation: 50% glycerol
• Gene: SULT2B1
• Gene Accession No.: NM_177973
• Gene Alias: HSST2
• Gene Symbols: SULT2B1
• Host Species: Mouse
• Immunogen: SULT2B1 (NP_814444, 1 a.a. ∼ 90 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6820
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum