sulfatase modifying factor 2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-575	50 μL

Catalog No. 89-004-575 Supplier Abnova Corporation Supplier No. H00025870A01

Description

Mouse polyclonal antibody raised against a partial recombinant SUMF2.

The catalytic sites of sulfatases are only active if they contain a unique amino acid, C-alpha-formylglycine (FGly). The FGly residue is posttranslationally generated from a cysteine by enzymes with FGly-generating activity. The gene described in this record is a member of the sulfatase-modifying factor family and encodes a protein with a DUF323 domain that localizes to the lumen of the endoplasmic reticulum. This protein has low levels of FGly-generating activity but can heterodimerize with another family member - a protein with high levels of FGly-generating activity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq

Sequence: QATSMVQLQGGRFLMGTNSPDSRDGEGPVREATVKPFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLPVEKAF

Specifications

• Antigen: sulfatase modifying factor 2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant SUMF2.
• Formulation: 50% glycerol
• Gene: SUMF2
• Gene Accession No.: NM_015411
• Gene Alias: DKFZp566I1024/DKFZp686I1024/DKFZp686L17160/DKFZp781L1035/MGC99485/pFGE
• Gene Symbols: SUMF2
• Host Species: Mouse
• Immunogen: SUMF2 (NP_056226, 26 a.a. ∼ 125 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 25870
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum