suppressor of Ty 16 homolog (S. cerevisiae), Mouse, Clone: 2D1, Abnova™

Catalog No.	Quantity
89-001-207	100 μg

Catalog No. 89-001-207 Supplier Abnova Corporation Supplier No. H00011198M02

Description

Mouse monoclonal antibody raised against a partial recombinant SUPT16H.

Transcription of protein-coding genes can be reconstituted on naked DNA with only the general transcription factors and RNA polymerase II. However, this minimal system cannot transcribe DNA packaged into chromatin, indicating that accessory factors may facilitate access to DNA. One such factor, FACT (facilitates chromatin transcription), interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT is composed of an 80kDa subunit and a 140kDa subunit; this gene encodes the 140kDa subunit. [provided by RefSeq

Sequence: PGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGE

Specifications

• Antigen: suppressor of Ty 16 homolog (S. cerevisiae)
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2D1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SUPT16H.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SUPT16H
• Gene Accession No.: NM_007192
• Gene Alias: CDC68/FACT/FACTP140/FLJ10857/FLJ14010/FLJ34357/SPT16/CDC68
• Gene Symbols: SUPT16H
• Host Species: Mouse
• Immunogen: SUPT16H (NP_009123, 608 a.a. ∼ 715 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 11198
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ