TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 250kDa, Mouse, Clone: 1G9, Abnova™

Catalog No.	Quantity
89-000-996	100 μg

Catalog No. 89-000-996 Supplier Abnova Corporation Supplier No. H00006872M02

Description

Mouse monoclonal antibody raised against a partial recombinant TAF1.

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is the basal transcription factor TFIID, which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes the largest subunit of TFIID. This subunit binds to core promoter sequences encompassing the transcription start site. It also binds to activators and other transcriptional regulators, and these interactions affect the rate of transcription initiation. This subunit contains two independent protein kinase domains at the N and C-terminals, but also possesses acetyltransferase activity and can act as a ubiquitin-activating/conjugating enzyme. This gene is part of a complex transcriptional unit (TAF1/DYT3), wherein some products share exons with TAF1 as well as additional exons downstream.[provided by RefSeq

Sequence: RMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE

Specifications

• Antigen: TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 250kDa
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1G9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TAF1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: TAF1
• Gene Accession No.: NM_004606
• Gene Alias: BA2R/CCG1/CCGS/DYT3/KAT4/N-TAF1/NSCL2/OF/P250/TAF2A/TAFII250
• Gene Symbols: TAF1
• Host Species: Mouse
• Immunogen: TAF1 (NP_004597, 1784 a.a. ∼ 1893 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6872
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ