TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-006-318	50 μL

Catalog No. 89-006-318 Supplier Abnova Corporation Supplier No. H00006883B01

Description

Mouse polyclonal antibody raised against a full-length human TAF12 protein.

Control of transcription by RNA polymerase II involves the basal transcription machinery which is a collection of proteins. These proteins with RNA polymerase II, assemble into complexes which are modulated by transactivator proteins that bind to cis-regulatory elements located adjacent to the transcription start site. Some modulators interact directly with the basal complex, whereas others may act as bridging proteins linking transactivators to the basal transcription factors. Some of these associated factors are weakly attached while others are tightly associated with TBP in the TFIID complex. Among the latter are the TAF proteins. Different TAFs are predicted to mediate the function of distinct transcriptional activators for a variety of gene promoters and RNA polymerases. TAF12 interacts directly with TBP as well as with TAF2I. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq

Sequence: MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK

Specifications

• Antigen: TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa
• Applications: Immunofluorescence, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human TAF12 protein.
• Formulation: No additive
• Gene: TAF12
• Gene Accession No.: BC011986
• Gene Alias: TAF2J/TAFII20
• Gene Symbols: TAF12
• Host Species: Mouse
• Immunogen: TAF12 (AAH11986, 1 a.a. ∼ 161 a.a) full-length human protein.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6883
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum