Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89014350

TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 210kDa-like, Mouse, Clone: 1E12, Abnova™

Catalog No. 89014350 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-350 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-350 Supplier Abnova Corporation Supplier No. H00138474M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant TAF1L.

This locus is intronless, and apparently arose in the primate lineage from retrotransposition of the transcript from the multi-exon TAF1 locus on the X chromosome. The gene is expressed in male germ cells, and the product has been shown to function interchangeably with the TAF1 product. [provided by RefSeq

Sequence: NIVTQKMMAVPDSWPFHHPVNKKFVPDYYKMIVNPVDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNICYQTITEYDEHLTQLEKDICTAK

Specifications

Antigen TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 210kDa-like
Applications ELISA, Immunohistochemistry (PFA fixed), Western Blot
Classification Monoclonal
Clone 1E12
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant TAF1L.
Formulation PBS with no preservative; pH 7.4
Gene TAF1L
Gene Accession No. NM_153809
Gene Alias MGC134910/TAF2A2
Gene Symbols TAF1L
Host Species Mouse
Immunogen TAF1L (NP_722516, 1532 a.a. ∼ 1641 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Kinases
Primary or Secondary Primary
Gene ID (Entrez) 138474
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.