TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 210kDa-like, Mouse, Clone: 1E12, Abnova™

Mouse monoclonal antibody raised against a partial recombinant TAF1L.

Supplier:  Abnova Corporation H00138474M01

Catalog No. 89-014-350

Description

This locus is intronless, and apparently arose in the primate lineage from retrotransposition of the transcript from the multi-exon TAF1 locus on the X chromosome. The gene is expressed in male germ cells, and the product has been shown to function interchangeably with the TAF1 product. [provided by RefSeq

Sequence: NIVTQKMMAVPDSWPFHHPVNKKFVPDYYKMIVNPVDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNICYQTITEYDEHLTQLEKDICTAK

Specifications

• Antigen: TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 210kDa-like
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_153809
• Gene Symbols: TAF1L
• Immunogen: TAF1L (NP_722516, 1532 a.a. ∼ 1641 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Kinases
• Gene ID (Entrez): 138474
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 1E12
• Description: Mouse monoclonal antibody raised against a partial recombinant TAF1L.
• Gene: TAF1L
• Gene Alias: MGC134910/TAF2A2
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody