TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-595	50 μL

Catalog No. 89-004-595 Supplier Abnova Corporation Supplier No. H00027097A01

Description

Mouse polyclonal antibody raised against a partial recombinant TAF5L.

The product of this gene belongs to the WD-repeat TAF5 family of proteins. This gene encodes a protein that is a component of the PCAF histone acetylase complex. The PCAF histone acetylase complex, which is composed of more than 20 polypeptides some of which are TAFs, is required for myogenic transcription and differentiation. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors to facilitate complex assembly and transcription initiation. The encoded protein is structurally similar to one of the histone-like TAFs, TAF5. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq

Sequence: MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVE

Specifications

• Antigen: TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant TAF5L.
• Formulation: 50% glycerol
• Gene: TAF5L
• Gene Accession No.: NM_014409
• Gene Alias: PAF65B
• Gene Symbols: TAF5L
• Host Species: Mouse
• Immunogen: TAF5L (NP_055224, 1 a.a. ∼ 117 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 27097
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum