TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa, Mouse, Clone: 3G6, Abnova™

Catalog No.	Quantity
89-000-997	100 μg

Catalog No. 89-000-997 Supplier Abnova Corporation Supplier No. H00006879M02

Description

Mouse monoclonal antibody raised against a partial recombinant TAF7.

The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II. [provided by RefSeq

Sequence: FIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFN

Specifications

• Antigen: TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3G6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TAF7.
• Formulation: PBS with no preservative; pH 7.4
• Gene: TAF7
• Gene Accession No.: BC032737
• Gene Alias: TAF2F/TAFII55
• Gene Symbols: TAF7
• Host Species: Mouse
• Immunogen: TAF7 (AAH32737, 130 a.a. ∼ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6879
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ