TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa, Mouse, Clone: 3G6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant TAF7.

Supplier:  Abnova Corporation H00006879M02

Catalog No. 89-000-997

Description

The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II. [provided by RefSeq

Sequence: FIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFN

Specifications

• Antigen: TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC032737
• Gene Symbols: TAF7
• Immunogen: TAF7 (AAH32737, 130 a.a. ∼ 224 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 6879
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 3G6
• Description: Mouse monoclonal antibody raised against a partial recombinant TAF7.
• Gene: TAF7
• Gene Alias: TAF2F/TAFII55
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody