TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-006-315	50 μL

Catalog No. 89-006-315 Supplier Abnova Corporation Supplier No. H00006879B01

Description

Mouse polyclonal antibody raised against a full-length human TAF7 protein.

The intronless gene for this transcription coactivator is located between the protocadherin beta and gamma gene clusters on chromosome 5. The protein encoded by this gene is a component of the TFIID protein complex, a complex which binds to the TATA box in class II promoters and recruits RNA polymerase II and other factors. This particular subunit interacts with the largest TFIID subunit, as well as multiple transcription activators. The protein is required for transcription by promoters targeted by RNA polymerase II. [provided by RefSeq

Sequence: MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQDEEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK

Specifications

• Antigen: TAF7 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 55kDa
• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human TAF7 protein.
• Formulation: No additive
• Gene: TAF7
• Gene Accession No.: NM_005642.2
• Gene Alias: TAF2F/TAFII55
• Gene Symbols: TAF7
• Host Species: Mouse
• Immunogen: TAF7 (NP_005633.2, 1 a.a. ∼ 349 a.a) full-length human protein.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6879
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum