T-box, brain, 1, Mouse, Clone: 3F6, Abnova™

Catalog No.	Quantity
89-014-266	100 μg

Catalog No. 89-014-266 Supplier Abnova Corporation Supplier No. H00010716M01

Description

Mouse monoclonal antibody raised against a partial recombinant TBR1.

This gene is a member of a conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. A similar protein has been disrupted in mice and shown to be critical for early cortical development, and causes loss of projection neurons in the olfactory bulbs and olfactory cortex. The C-terminal region this similar protein was found to be necessary and sufficient for association with the guanylate kinase domain of calcium/calmodulin-dependent serine protein kinase. [provided by RefSeq

Sequence: MQLEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFDGSAADRYLLS

Specifications

• Antigen: T-box, brain, 1
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 3F6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TBR1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: TBR1
• Gene Accession No.: NM_006593
• Gene Alias: MGC141978/TES-56
• Gene Symbols: TBR1
• Host Species: Mouse
• Immunogen: TBR1 (NP_006584, 1 a.a. ∼ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 10716
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ