T-box 6, Mouse, Clone: 1D11, Abnova™

Catalog No.	Quantity
89-001-000	100 μg

Catalog No. 89-001-000 Supplier Abnova Corporation Supplier No. H00006911M06

Description

Mouse monoclonal antibody raised against a partial recombinant TBX6.

This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Knockout studies in mice indicate that this gene is important for specification of paraxial mesoderm structures. [provided by RefSeq

Sequence: SFHRVKLTNSTLDPHGHLILHSMHKYQPRIHLVRAAQLCSQHWGGMASFRFPETTFISVTAYQNPQITQLKIAANPFAKGFRENGRNCKRERDARVKRKLRGPEPAATE

Specifications

• Antigen: T-box 6
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 1D11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TBX6.
• Formulation: PBS with no preservative; pH 7.4
• Gene: TBX6
• Gene Accession No.: NM_004608
• Gene Alias: DFNB67
• Gene Symbols: TBX6
• Host Species: Mouse
• Immunogen: TBX6 (NP_004599, 191 a.a. ∼ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6911
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ