TEA domain family member 4, Mouse, Clone: 1D10, Abnova™

Catalog No.	Quantity
89-001-008	100 μg

Catalog No. 89-001-008 Supplier Abnova Corporation Supplier No. H00007004M12

Description

Mouse monoclonal antibody raised against a full-length recombinant TEAD4.

This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene. [provided by RefSeq

Sequence: MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Specifications

• Antigen: TEA domain family member 4
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 1D10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant TEAD4.
• Formulation: PBS with no preservative; pH 7.4
• Gene: TEAD4
• Gene Accession No.: BC015497
• Gene Alias: EFTR-2/MGC9014/RTEF1/TCF13L1/TEF-3/TEFR-1/hRTEF-1B
• Gene Symbols: TEAD4
• Host Species: Mouse
• Immunogen: TEAD4 (AAH15497, 1 a.a. ∼ 361 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Stem Cell Biology
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 7004
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ