TEK tyrosine kinase, endothelial, Mouse, Clone: 1A4, Abnova™

Catalog No.	Quantity
89-001-009	100 μg

Catalog No. 89-001-009 Supplier Abnova Corporation Supplier No. H00007010M03

Description

Mouse monoclonal antibody raised against a partial recombinant TEK.

The TEK receptor tyrosine kinase is expressed almost exclusively in endothelial cells in mice, rats, and humans. This receptor possesses a unique extracellular domain containing 2 immunoglobulin-like loops separated by 3 epidermal growth factor-like repeats that are connected to 3 fibronectin type III-like repeats. The ligand for the receptor is angiopoietin-1. Defects in TEK are associated with inherited venous malformations; the TEK signaling pathway appears to be critical for endothelial cell-smooth muscle cell communication in venous morphogenesis. TEK is closely related to the TIE receptor tyrosine kinase. [provided by RefSeq

Sequence: AFSHELVTLPESQAPADLGGGKMLLIAILGSAGMTCLTVLLAFLIILQLKRANVQRRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWND

Specifications

• Antigen: TEK tyrosine kinase, endothelial
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1A4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TEK.
• Formulation: PBS with no preservative; pH 7.4
• Gene: TEK
• Gene Accession No.: BC035514
• Gene Alias: CD202B/TIE-2/TIE2/VMCM/VMCM1
• Gene Symbols: TEK
• Host Species: Mouse
• Immunogen: TEK (AAH35514, 701 a.a. ∼ 800 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 7010
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ