testis-specific kinase 2, Mouse, Clone: 6C7, Abnova™

Catalog No.	Quantity
89-001-179	100 μg

Catalog No. 89-001-179 Supplier Abnova Corporation Supplier No. H00010420M02

Description

Mouse monoclonal antibody raised against a partial recombinant TESK2.

This gene product is a serine/threonine protein kinase that contains an N-terminal protein kinase domain that is structurally similar to the kinase domains of testis-specific protein kinase-1 and the LIM motif-containing protein kinases (LIMKs). Its overall structure is most related to the former, indicating that it belongs to the TESK subgroup of the LIMK/TESK family of protein kinases. This gene is predominantly expressed in testis and prostate. The developmental expression pattern of the rat gene in testis suggests an important role for this gene in meitoic stages and/or early stages of spermiogenesis. [provided by RefSeq

Sequence: GPGTMPLADWQEPLAPPIRRWCSLPGSPEFLHQEACPFVGREESLSDGPPPRLSSLKYRVKEIPPFRASALPAAQAHEAMDCSILQEENGFGSRPQGTSPCPAGASEEMEVEERPAGSTPATFSTSGIGLQTQGKQDG

Specifications

• Antigen: testis-specific kinase 2
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 6C7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TESK2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: TESK2
• Gene Accession No.: BC033085
• Gene Symbols: TESK2
• Host Species: Mouse
• Immunogen: TESK2 (AAH33085, 405 a.a. ∼ 542 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Apoptosis
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 10420
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ