Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TF, Mouse, Clone: 1C2, Abnova™

Catalog No. 89002702 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-002-702 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-002-702 Supplier Abnova Corporation Supplier No. H00007018M08
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant TF.

This gene encodes a glycoprotein with an approximate molecular weight of 76.5kDa. It is thought to have been created as a result of an ancient gene duplication event that led to generation of homologous C and N-terminal domains each of which binds one ion of ferric iron. The function of this protein is to transport iron from the intestine, reticuloendothelial system, and liver parenchymal cells to all proliferating cells in the body. This protein may also have a physiologic role as granulocyte/pollen-binding protein (GPBP) involved in the removal of certain organic matter and allergens from serum. [provided by RefSeq

Sequence: FVKHQTVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLARAPNHAVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLFRSETKDLLF

Specifications

Antigen TF
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 1C2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant TF.
Formulation PBS with no preservative; pH 7.4
Gene TF
Gene Accession No. BC059367
Gene Alias DKFZp781D0156/PRO1557/PRO2086
Gene Symbols TF
Host Species Mouse
Immunogen TF (AAH59367, 551 a.a. ∼ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7018
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.