Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TF, Mouse, Clone: 1C2, Abnova™

Mouse monoclonal antibody raised against a partial recombinant TF.

Manufacturer:  Abnova Corporation H00007018M08

Catalog No. 89-002-702


Add to cart

Description

Description

This gene encodes a glycoprotein with an approximate molecular weight of 76.5kDa. It is thought to have been created as a result of an ancient gene duplication event that led to generation of homologous C and N-terminal domains each of which binds one ion of ferric iron. The function of this protein is to transport iron from the intestine, reticuloendothelial system, and liver parenchymal cells to all proliferating cells in the body. This protein may also have a physiologic role as granulocyte/pollen-binding protein (GPBP) involved in the removal of certain organic matter and allergens from serum. [provided by RefSeq

Sequence: FVKHQTVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLARAPNHAVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLFRSETKDLLF
Specifications

Specifications

TF
1C2
Mouse monoclonal antibody raised against a partial recombinant TF.
TF
Liquid
TF
TF (AAH59367, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA, Immunofluorescence, Western Blot
Unconjugated
In 1X PBS, pH 7.4
BC059367
DKFZp781D0156|PRO1557|PRO2086
Mouse
IgG2a Kappa
RUO
Primary
7018
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit