TFAM, Rabbit, MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-002-916	100 μL

Catalog No. 89-002-916 Supplier Abnova Corporation Supplier No. H00007019D01

Description

Rabbit polyclonal antibody raised against a full-length human TFAM protein.

This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells. [provided by RefSeq

Sequence: MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC

Specifications

• Antigen: TFAM
• Applications: Immunoprecipitation, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against a full-length human TFAM protein.
• Formulation: No additive
• Gene: TFAM
• Gene Accession No.: NM_003201.1
• Gene Alias: MtTF1/TCF6/TCF6L1/TCF6L2/TCF6L3/mtTFA
• Gene Symbols: TFAM
• Host Species: Rabbit
• Immunogen: TFAM (NP_003192.1, 1 a.a. ∼ 246 a.a) full-length human protein.
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 7019
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid