transcription factor AP-2 beta (activating enhancer binding protein 2 beta), Mouse, Clone: 2F6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant TFAP2B.

Supplier:  Abnova Corporation H00007021M02

Catalog No. 89-001-010

Description

This gene encodes a member of the AP-2 family of transcription factors. AP-2 proteins form homo- or hetero-dimers with other AP-2 family members and bind specific DNA sequences. They are thought to stimulate cell proliferation and suppress terminal differentiation of specific cell types during embryonic development. Specific AP-2 family members differ in their expression patterns and binding affinity for different promoters. This protein functions as both a transcriptional activator and repressor. Mutations in this gene result in autosomal dominant Char syndrome, suggesting that this gene functions in the differentiation of neural crest cell derivatives. [provided by RefSeq

Sequence: DPYSHVNDPYSLNPLHQPQQHPWGQRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMGDSLSLHGLGHPGMEDVQSVEDANNSGMNLL

Specifications

• Antigen: transcription factor AP-2 beta (activating enhancer binding protein 2 beta)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_003221
• Gene Symbols: TFAP2B
• Immunogen: TFAP2B (NP_003212, 73 a.a. ∼ 182 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Neurobiology
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 2F6
• Description: Mouse monoclonal antibody raised against a partial recombinant TFAP2B.
• Gene: TFAP2B
• Gene Alias: AP-2B/AP2-B/MGC21381
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 7021
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ