transcription factor AP-4 (activating enhancer binding protein 4), Mouse, Clone: 7A10, Abnova™

Catalog No.	Quantity
89-001-011	100 μg

Catalog No. 89-001-011 Supplier Abnova Corporation Supplier No. H00007023M03

Description

Mouse monoclonal antibody raised against a partial recombinant TFAP4.

Transcription factors of the basic helix-loop-helix-zipper (bHLH-ZIP) family contain a basic domain, which is used for DNA binding, and HLH and ZIP domains, which are used for oligomerization. Transcription factor AP4 activates both viral and cellular genes by binding to the symmetrical DNA sequence CAGCTG (Mermod et al., 1988 [PubMed 2833704]; Hu et al., 1990 [PubMed 2123466]).[supplied by OMIM

Sequence: AEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIA

Specifications

• Antigen: transcription factor AP-4 (activating enhancer binding protein 4)
• Applications: ELISA, Immunohistochemistry (PFA fixed), KnockDown, Western Blot
• Classification: Monoclonal
• Clone: 7A10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TFAP4.
• Formulation: PBS with no preservative; pH 7.4
• Gene: TFAP4
• Gene Accession No.: NM_003223
• Gene Alias: AP-4/bHLHc41
• Gene Symbols: TFAP4
• Host Species: Mouse
• Immunogen: TFAP4 (NP_003214, 93 a.a. ∼ 192 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 7023
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ