transcription factor AP-4 (activating enhancer binding protein 4), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant TFAP4.

Supplier:  Abnova Corporation H00007023A01

Catalog No. 89-004-336

Description

Transcription factors of the basic helix-loop-helix-zipper (bHLH-ZIP) family contain a basic domain, which is used for DNA binding, and HLH and ZIP domains, which are used for oligomerization. Transcription factor AP4 activates both viral and cellular genes by binding to the symmetrical DNA sequence CAGCTG (Mermod et al., 1988 [PubMed 2833704]; Hu et al., 1990 [PubMed 2123466]).[supplied by OMIM

Sequence: AEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLEAHMYPEKLKVIA

Specifications

• Antigen: transcription factor AP-4 (activating enhancer binding protein 4)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant TFAP4.
• Gene: TFAP4
• Gene Alias: AP-4/bHLHc41
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_003223
• Gene Symbols: TFAP4
• Immunogen: TFAP4 (NP_003214, 93 a.a. ∼ 192 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 7023
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.