TGFB1, Mouse, Clone: 4E1, Abnova™

Catalog No.	Quantity
89-123-118	200 μL

Catalog No. 89-123-118 Supplier Abnova Corporation Supplier No. H00007040M02A

Description

Mouse monoclonal antibody raised against a partial recombinant TGFB1.

TGFB is a multifunctional peptide that controls proliferation, differentiation, and other functions in many cell types. TGFB acts synergistically with TGFA (MIM 190170) in inducing transformation. It also acts as a negative autocrine growth factor. Dysregulation of TGFB activation and signaling may result in apoptosis. Many cells synthesize TGFB and almost all of them have specific receptors for this peptide. TGFB1, TGFB2 (MIM 190220), and TGFB3 (MIM 190230) all function through the same receptor signaling systems.[supplied by OMIM

Sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Specifications

• Antigen: TGFB1
• Applications: ELISA
• Classification: Monoclonal
• Clone: 4E1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TGFB1.
• Formulation: ascites with no preservative
• Gene: TGFB1
• Gene Accession No.: NM_000660
• Gene Alias: CED/DPD1/TGFB/TGFbeta
• Gene Symbols: TGFB1
• Host Species: Mouse
• Immunogen: TGFB1 (NP_000651, 279 a.a. ∼ 390 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 7040
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgG