transforming growth factor, beta receptor II (70/80kDa), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-340	50 μL

Catalog No. 89-004-340 Supplier Abnova Corporation Supplier No. H00007048A01

Description

Mouse polyclonal antibody raised against a partial recombinant TGFBR2.

This gene encodes a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. The encoded protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different isoforms have been characterized. [provided by RefSeq

Sequence: IVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSS

Specifications

• Antigen: transforming growth factor, beta receptor II (70/80kDa)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant TGFBR2.
• Formulation: 50% glycerol
• Gene: TGFBR2
• Gene Accession No.: NM_001024847
• Gene Alias: AAT3/FAA3/LDS1B/LDS2B/MFS2/RIIC/TAAD2/TGFR-2/TGFbeta-RII
• Gene Symbols: TGFBR2
• Host Species: Mouse
• Immunogen: TGFBR2 (NP_001020018, 62 a.a. ∼ 165 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 7048
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum