mediator complex subunit 16, Mouse, Clone: 2B7, Abnova™

Mouse monoclonal antibody raised against a partial recombinant THRAP5.

Supplier:  Abnova Corporation H00010025M02

Catalog No. 89-001-161

Description

Sequence: MCDLRRPAAGGMMDLAYVCEWEKWSKSTHCPSVPLACAWSCRNLIAFTMDLRSDDQDLTRMIHILDTEHPWDLHSIPSEHHEAITCLEWDQSGSRLLSADADGQIKCWSM

Specifications

• Antigen: mediator complex subunit 16
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC017282
• Gene Symbols: MED16
• Immunogen: THRAP5 (AAH17282, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Signal Transduction
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 2B7
• Description: Mouse monoclonal antibody raised against a partial recombinant THRAP5.
• Gene: MED16
• Gene Alias: DRIP92/THRAP5/TRAP95
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 10025
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ