TIA1 cytotoxic granule-associated RNA binding protein-like 1 (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant TIAL1.

Supplier:  Abnova Corporation H00007073A01

Catalog No. 89-004-343

Description

The protein encoded by this gene is a member of a family of RNA-binding proteins, has three RNA recognition motifs (RRMs), and binds adenine and uridine-rich elements in mRNA and pre-mRNAs of a wide range of genes. It regulates various activities including translational control, splicing and apoptosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The different isoforms have been show to function differently with respect to post-transcriptional silencing. [provided by RefSeq

Sequence: MMEDDGQPRTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWATTPSSQK

Specifications

• Antigen: TIA1 cytotoxic granule-associated RNA binding protein-like 1
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant TIAL1.
• Gene: TIAL1
• Gene Alias: MGC33401/TCBP/TIAR
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Apoptosis
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_003252
• Gene Symbols: TIAL1
• Immunogen: TIAL1 (NP_003243, 1 a.a. ∼ 90 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 7073
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.