TIA1 cytotoxic granule-associated RNA binding protein-like 1 (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-343	50 μL

Catalog No. 89-004-343 Supplier Abnova Corporation Supplier No. H00007073A01

Description

Mouse polyclonal antibody raised against a partial recombinant TIAL1.

The protein encoded by this gene is a member of a family of RNA-binding proteins, has three RNA recognition motifs (RRMs), and binds adenine and uridine-rich elements in mRNA and pre-mRNAs of a wide range of genes. It regulates various activities including translational control, splicing and apoptosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The different isoforms have been show to function differently with respect to post-transcriptional silencing. [provided by RefSeq

Sequence: MMEDDGQPRTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWATTPSSQK

Specifications

• Antigen: TIA1 cytotoxic granule-associated RNA binding protein-like 1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant TIAL1.
• Formulation: 50% glycerol
• Gene: TIAL1
• Gene Accession No.: NM_003252
• Gene Alias: MGC33401/TCBP/TIAR
• Gene Symbols: TIAL1
• Host Species: Mouse
• Immunogen: TIAL1 (NP_003243, 1 a.a. ∼ 90 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Apoptosis
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 7073
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum