TIMM8A, Mouse, Clone: 1A12, Abnova™

Catalog No.	Quantity
89-123-149	100 μg

Catalog No. 89-123-149 Supplier Abnova Corporation Supplier No. H00001678M04

Description

Mouse monoclonal antibody raised against a full-length recombinant TIMM8A.

This translocase is involved in the import and insertion of hydrophobic membrane proteins from the cytoplasm into the mitochondrial inner membrane. The gene is mutated in Mohr-Tranebjaerg syndrome/Deafness Dystonia Syndrome (MTS/DDS) and it is postulated that MTS/DDS is a mitochondrial disease caused by a defective mitochondrial protein import system. Defects in this gene also cause Jensen syndrome; an X-linked disease with opticoacoustic nerve atrophy and muscle weakness. This protein, along with TIMM13, forms a 70kDa heterohexamer. Alternative splicing results in multiple transcript variants encoding distinct isoforms

Sequence: MLLNDKWVNEEIKKKIEKCLETNDNGNTTYQNLWDTAKAVVRGKFIAISTYIKKEEKLQINNLTMNLIELEN

Specifications

• Antigen: TIMM8A
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1A12
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant TIMM8A.
• Formulation: PBS with no preservative; pH 7.4
• Gene: TIMM8A
• Gene Accession No.: BC005236
• Gene Alias: DDP/DDP1/DFN1/MGC12262/MTS
• Gene Symbols: TIMM8A
• Host Species: Mouse
• Immunogen: TIMM8A (AAH05236, 1 a.a. ∼ 72 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1678
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ