TIMP metallopeptidase inhibitor 2, Mouse, Clone: 1C3, Abnova™

Catalog No.	Quantity
89-001-020	100 μg

Catalog No. 89-001-020 Supplier Abnova Corporation Supplier No. H00007077M03J

Description

Mouse monoclonal antibody raised against a full-length recombinant TIMP2.

This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix. [provided by RefSeq

Sequence: CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Specifications

• Antigen: TIMP metallopeptidase inhibitor 2
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 1C3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant TIMP2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: TIMP2
• Gene Accession No.: BC052605
• Gene Alias: CSC-21K
• Gene Symbols: TIMP2
• Host Species: Mouse
• Immunogen: TIMP2 (AAH52605, 27 a.a. ∼ 220 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 7077
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ