toll-like receptor 1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-018-846	50 μL

Catalog No. 89-018-846 Supplier Abnova Corporation Supplier No. H00007096A01

Description

Mouse polyclonal antibody raised against a partial recombinant TLR1.

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is ubiquitously expressed, and at higher levels than other TLR genes. Different length transcripts presumably resulting from use of alternative polyadenylation site, and/or from alternative splicing, have been noted for this gene. [provided by RefSeq

Sequence: EIFSNMNIKNFTVSGTRMVHMLCPSKISPFLHLDFSNNLLTDTVFENCGHLTELETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCS

Specifications

• Antigen: toll-like receptor 1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant TLR1.
• Formulation: 50% glycerol
• Gene: TLR1
• Gene Accession No.: NM_003263
• Gene Alias: CD281/DKFZp547I0610/DKFZp564I0682/KIAA0012/MGC104956/MGC126311/MGC126312/TIL/rsc786
• Gene Symbols: TLR1
• Host Species: Mouse
• Immunogen: TLR1 (NP_003254, 321 a.a. ∼ 420 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Membrane Receptors
• Primary or Secondary: Primary
• Gene ID (Entrez): 7096
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum