toll-like receptor 4, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-344	50 μL

Catalog No. 89-004-344 Supplier Abnova Corporation Supplier No. H00007099A01

Description

Mouse polyclonal antibody raised against a partial recombinant TLR4.

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor is most abundantly expressed in placenta, and in myelomonocytic subpopulation of the leukocytes. It has been implicated in signal transduction events induced by lipopolysaccharide (LPS) found in most gram-negative bacteria. Mutations in this gene have been associated with differences in LPS responsiveness. Also, several transcript variants of this gene have been found, but the protein coding potential of most of them is uncertain. [provided by RefSeq

Sequence: PMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLA

Specifications

• Antigen: toll-like receptor 4
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant TLR4.
• Formulation: 50% glycerol
• Gene: TLR4
• Gene Accession No.: NM_138554
• Gene Alias: ARMD10/CD284/TOLL/hToll
• Gene Symbols: TLR4
• Host Species: Mouse
• Immunogen: TLR4 (NP_612564, 214 a.a. ∼ 291 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Membrane Receptors
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 7099
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum