toll-like receptor 5, Mouse, Clone: 3E4, Abnova™

Catalog No.	Quantity
89-001-026	100 μg

Catalog No. 89-001-026 Supplier Abnova Corporation Supplier No. H00007100M02

Description

Mouse monoclonal antibody raised against a partial recombinant TLR5.

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene product is expressed in myelomonocytic cells, and recognizes bacterial flagellin, a principal component of bacterial flagella and a virulence factor. The activation of this receptor mobilizes the nuclear factor NF-kappaB and stimulates tumour necrosis factor-alpha production. [provided by RefSeq

Sequence: LPPGVFSHLTALRGLSLNSNRLTVLSHNDLPANLEILDISRNQLLAPNPDVFVSLSVLDITHNKFICECELSTFINWLNHTNVTIAGPPADIYCVYPDSFSGVSLFSLSTEGCDEEEV

Specifications

• Antigen: toll-like receptor 5
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3E4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TLR5.
• Formulation: PBS with no preservative; pH 7.4
• Gene: TLR5
• Gene Accession No.: NM_003268
• Gene Alias: FLJ10052/MGC126430/MGC126431/SLEB1/TIL3
• Gene Symbols: TLR5
• Host Species: Mouse
• Immunogen: TLR5 (NP_003259, 517 a.a. ∼ 634 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Membrane Receptors
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 7100
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ