toll-like receptor 8, Mouse, Clone: 4C6, Abnova™

Catalog No.	Quantity
89-001-281	100 μg

Catalog No. 89-001-281 Supplier Abnova Corporation Supplier No. H00051311M01

Description

Mouse monoclonal antibody raised against a partial recombinant TLR8.

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is predominantly expressed in lung and peripheral blood leukocytes, and lies in close proximity to another family member, TLR7, on chromosome X. [provided by RefSeq

Sequence: RISHLPSGFLSEVSSLKHLDLSSNLLKTINKSALETKTTTKLSMLELHGNPFECTCDIGDFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSLELTTCVSD

Specifications

• Antigen: toll-like receptor 8
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4C6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TLR8.
• Formulation: PBS with no preservative; pH 7.4
• Gene: TLR8
• Gene Accession No.: NM_138636
• Gene Alias: CD288/MGC119599/MGC119600
• Gene Symbols: TLR8
• Host Species: Mouse
• Immunogen: TLR8 (NP_619542, 723 a.a. ∼ 825 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Membrane Receptors
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 51311
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ