Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89001265

T-cell leukemia homeobox 3, Mouse, Clone: 5B11, Abnova™

Catalog No. 89001265 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-265 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-265 Supplier Abnova Corporation Supplier No. H00030012M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant TLX3.

RNX (HOX11L2, TLX3) belongs to a family of orphan homeobox genes that encode DNA-binding nuclear transcription factors. Members of the HOX11 gene family are characterized by a threonine-47 replacing cytosine in the highly conserved homeodomain (Dear et al., 1993 [PubMed 8099440]).[supplied by OMIM

Sequence: ASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEEDSSKVPAVTSLV

Specifications

Antigen T-cell leukemia homeobox 3
Applications ELISA, Western Blot
Classification Monoclonal
Clone 5B11
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant TLX3.
Formulation PBS with no preservative; pH 7.4
Gene TLX3
Gene Accession No. NM_021025
Gene Alias HOX11L2/MGC29804/RNX
Gene Symbols TLX3
Host Species Mouse
Immunogen TLX3 (NP_066305, 192 a.a. ∼ 291 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Transcription Regulation
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 30012
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.