thymosin beta 4, X-linked, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human TMSB4X protein.

Supplier:  Abnova Corporation H00007114B01P

Catalog No. 89-015-802

Description

This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y. [provided by RefSeq

Sequence: MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Specifications

• Antigen: thymosin beta 4, X-linked
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human TMSB4X protein.
• Gene: TMSB4X
• Gene Alias: FX/PTMB4/TB4X/TMSB4
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 7114
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG

• Applications: Immunofluorescence, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC001631
• Gene Symbols: TMSB4X
• Immunogen: TMSB4X (AAH01631.1, 1 a.a. ∼ 44 a.a) full-length human protein.
• Quantity: 50 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody