TNF, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-094	50 μL

Catalog No. 89-003-094 Supplier Abnova Corporation Supplier No. H00007124A01

Description

Mouse polyclonal antibody raised against a partial recombinant TNF.

This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine. [provided by RefSeq

Sequence: LVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Specifications

• Antigen: TNF
• Applications: ELISA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant TNF.
• Formulation: 50% glycerol
• Gene: TNF
• Gene Accession No.: NM_000594
• Gene Alias: DIF/TNF-alpha/TNFA/TNFSF2
• Gene Symbols: TNF
• Host Species: Mouse
• Immunogen: TNF (NP_000585, 124 a.a. ∼ 233 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 7124
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid