tumor necrosis factor, alpha-induced protein 2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant TNFAIP2.

Supplier:  Abnova Corporation H00007127A01

Catalog No. 89-004-347

Description

This gene was identified as a gene whose expression can be induced by the tumor necrosis factor alpha (TNF) in umbilical vein endothelial cells. The expression of this gene was shown to be induced by retinoic acid in a cell line expressing a oncogenic version of the retinoic acid receptor alpha fusion protein, which suggested that this gene may be a retinoic acid target gene in acute promyelocytic leukemia. [provided by RefSeq

Sequence: YILANADTIQHFCTQHGSPATWLQPALPTLAEIIRLQDPSAIKIEVATYATCYPDFSKGHLSAILAIKGNLSNSEVKRIRSILDVSMGAQEPSRPLFSL

Specifications

• Antigen: tumor necrosis factor, alpha-induced protein 2
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant TNFAIP2.
• Gene: TNFAIP2
• Gene Alias: B94
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Angiogenesis
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_006291
• Gene Symbols: TNFAIP2
• Immunogen: TNFAIP2 (NP_006282, 552 a.a. ∼ 650 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 7127
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.