tumor necrosis factor, alpha-induced protein 2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-347	50 μL

Catalog No. 89-004-347 Supplier Abnova Corporation Supplier No. H00007127A01

Description

Mouse polyclonal antibody raised against a partial recombinant TNFAIP2.

This gene was identified as a gene whose expression can be induced by the tumor necrosis factor alpha (TNF) in umbilical vein endothelial cells. The expression of this gene was shown to be induced by retinoic acid in a cell line expressing a oncogenic version of the retinoic acid receptor alpha fusion protein, which suggested that this gene may be a retinoic acid target gene in acute promyelocytic leukemia. [provided by RefSeq

Sequence: YILANADTIQHFCTQHGSPATWLQPALPTLAEIIRLQDPSAIKIEVATYATCYPDFSKGHLSAILAIKGNLSNSEVKRIRSILDVSMGAQEPSRPLFSL

Specifications

• Antigen: tumor necrosis factor, alpha-induced protein 2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant TNFAIP2.
• Formulation: 50% glycerol
• Gene: TNFAIP2
• Gene Accession No.: NM_006291
• Gene Alias: B94
• Gene Symbols: TNFAIP2
• Host Species: Mouse
• Immunogen: TNFAIP2 (NP_006282, 552 a.a. ∼ 650 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Angiogenesis
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 7127
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum