tumor necrosis factor receptor superfamily, member 10a, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant TNFRSF10A.

Supplier:  Abnova Corporation H00008797A02

Catalog No. 89-004-403

Description

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL), and thus transduces cell death signal and induces cell apoptosis. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. [provided by RefSeq

Sequence: PSSAATIKLHDQSIGTQQWEHSPLGELCPPGSHRSERPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMC

Specifications

• Antigen: tumor necrosis factor receptor superfamily, member 10a
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant TNFRSF10A.
• Gene: TNFRSF10A
• Gene Alias: APO2/CD261/DR4/MGC9365/TRAILR-1/TRAILR1
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Apoptosis
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: BC012866
• Gene Symbols: TNFRSF10A
• Immunogen: TNFRSF10A (AAH12866, 105 a.a. ∼ 204 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 8797
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.