RELT tumor necrosis factor receptor, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-750	50 μL

Catalog No. 89-004-750 Supplier Abnova Corporation Supplier No. H00084957A01

Description

Mouse polyclonal antibody raised against a partial recombinant TNFRSF19L.

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is especially abundant in hematologic tissues. It has been shown to activate the NF-kappaB pathway and selectively bind TNF receptor-associated factor 1 (TRAF1). This receptor is capable of stimulating T-cell proliferation in the presence of CD3 signaling, which suggests its regulatory role in immune response. Two alternatively spliced transcript variants of this gene encoding the same protein have been reported. [provided by RefSeq

Sequence: STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEW

Specifications

• Antigen: RELT tumor necrosis factor receptor
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant TNFRSF19L.
• Formulation: 50% glycerol
• Gene: RELT
• Gene Accession No.: NM_032871
• Gene Alias: FLJ14993/TNFRSF19L
• Gene Symbols: RELT
• Host Species: Mouse
• Immunogen: TNFRSF19L (NP_116260, 26 a.a. ∼ 124 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Membrane Receptors
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 84957
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum