tumor necrosis factor receptor superfamily, member 1A, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-018-848	50 μL

Catalog No. 89-018-848 Supplier Abnova Corporation Supplier No. H00007132A01

Description

Mouse polyclonal antibody raised against a partial recombinant TNFRSF1A.

The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is one of the major receptors for the tumor necrosis factor-alpha. This receptor can activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the autosomal dominant periodic fever syndrome. The impaired receptor clearance is thought to be a mechanism of the disease. [provided by RefSeq

Sequence: RDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLC

Specifications

• Antigen: tumor necrosis factor receptor superfamily, member 1A
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant TNFRSF1A.
• Formulation: 50% glycerol
• Gene: TNFRSF1A
• Gene Accession No.: NM_001065
• Gene Alias: CD120a/FPF/MGC19588/TBP1/TNF-R/TNF-R-I/TNF-R55/TNFAR/TNFR1/TNFR55/TNFR60/p55/p55-R/p60
• Gene Symbols: TNFRSF1A
• Host Species: Mouse
• Immunogen: TNFRSF1A (NP_001056, 40 a.a. ∼ 149 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Apoptosis
• Primary or Secondary: Primary
• Gene ID (Entrez): 7132
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum