TNFRSF8, Mouse, Clone: 4C9, Abnova™

Catalog No.	Quantity
89-016-494	100 μg

Catalog No. 89-016-494 Supplier Abnova Corporation Supplier No. H00000943M02

Description

Mouse monoclonal antibody raised against a partial recombinant TNFRSF8.

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq

Sequence: QDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPA

Specifications

• Antigen: TNFRSF8
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4C9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant TNFRSF8.
• Formulation: PBS with no preservative; pH 7.4
• Gene: TNFRSF8
• Gene Accession No.: NM_001243
• Gene Alias: CD30/D1S166E/KI-1
• Gene Symbols: TNFRSF8
• Host Species: Mouse
• Immunogen: TNFRSF8 (NP_001234, 21 a.a. ∼ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 943
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ