target of myb1 (chicken), Mouse, Clone: 5A3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant TOM1.

Supplier:  Abnova Corporation H00010043M01

Catalog No. 89-014-250

Description

This gene was identified as a target of the v-myb oncogene. The encoded protein shares its N-terminal domain in common with proteins associated with vesicular trafficking at the endosome. It is recruited to the endosomes by its interaction with endofin. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: GLAGALDARQQSTGAIPVTQACLMEDIEQWLSTDVGNDAEEPKGVTSEEFDKFLEERAKAADRLPNLSSPSAEGPPGPPSGPAPRKKTQEKDDDMLFA

Specifications

• Antigen: target of myb1 (chicken)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_005488
• Gene Symbols: TOM1
• Immunogen: TOM1 (NP_005479, 394 a.a. ∼ 491 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 5A3
• Description: Mouse monoclonal antibody raised against a partial recombinant TOM1.
• Gene: TOM1
• Gene Alias: FLJ33404
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10043
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ